Stable-Basic Fibroblast Growth factor
recombinant, Human
expressed in E.Coli
Catalog Number
GR 005-010 (10ug)
GR 005-050 (50ug)
GR 005-200 (200ug)
Storage Temperature -5 ~ -20°C
Precautions
For In Vitro Use Only
Product Description
Insulin-like Growth Factor-1 (IGF-1) is a hormone consisting of 70 amino acids showing a similar molecular structure to insulin and plays a crucial role in growth and development. It is mainly produced by the liver, but also by other tissues, including muscles, bones, and cartilage.
The primary function of IGF-1 is to promote cell growth and division, particularly in bone, muscle, and cartilage tissues. IGF-1 plays roles by binding to the IGF-1 receptor (IGF-1R) on the surface of cells, which triggers a cascade of signaling events that activate various intracellular pathways, such as the PI3K/AKT and MAPK/ERK pathways. These pathways regulate cellular processes such as protein synthesis, cell proliferation, and differentiation.
IGF-1 is regulated by growth hormone (GH), which is produced by the pituitary gland. GH stimulates the liver to produce IGF-1, which is released into the bloodstream and circulates to target tissues.
Product Information
Alternative Names :
Insulin like growth factor 1, IGF1, IGF-I, IGF1A, IGFI, MGF, IGF
Species : Human
Source : E. Coli
Predicted Molecular Mass : 7.7 kDa
Amino Acid Sequence :
GPETLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMY CAPLKPAKSA
Formulation :
Lyophilized from a sterile-filtered aqueous solution containing 20mM Sodium Phosphate, pH 7.0.
Product Specifications
Biological activity :
The EC50 ≤ 2.0 ng/mL as determined by a cell proliferation assay using BALB/ 3T3 cells.
Purity :
≥ 95% purity by SDS-PAGE
Endotoxin :
≤ 0.5 EU/mg protein by LAL(Limulus amebocyte lysate) analysis method.
Preparation and Storage
Storage :
Store at -5 °C to -20 °C.
Stability :
Stable as supplied for 12 months from date of receipt.
Preparation :
Centrifuge vial before opening. Reconstitute the product in sterile water to at least 0.1 mg/mL by pipetting the solution down the sides of the vial. Do not vortex
DATA
(A) The biological activity of Human Recombinant IGF-1 was tested by its ability to promote the proliferation of BALB/c 3T3 cells. Cell proliferation was measured using a fluorometric assay method. The EC50 is defined as the effective concentration of the growth factor at which cell proliferation is at 50% of maximum. The EC50 in the under example is 1.85 ng/mL.
(B) Human Recombinant IGF-1 was resolved with SDS-PAGE under and visualized by Coomassie Blue staining. Human Recombinant IGF-1 has a predicted molecular mass of 7.7 kDa.

본 제품은 ISO13485:2016 인증 품질경영시스템 하에서 제조되었습니다.
This product is manufactured under an ISO 13485:2016-certified quality management system.